missing translation for 'onlineSavingsMsg'
Learn More
Learn More
FLJ37543 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | FLJ37543 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
FLJ37543 Polyclonal specifically detects FLJ37543 in Human samples. It is validated for Western Blot.Specifications
| FLJ37543 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| chromosome 5 open reading frame 64 | |
| C5orf64 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_775938 | |
| 285668 | |
| Synthetic peptide directed towards the middle region of human FLJ37543The immunogen for this antibody is FLJ37543. Peptide sequence PAVFYNQYFKHPKCVGEYGPKNGAERQIEERKVLPTTMMFSMLADCVLKS. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title