missing translation for 'onlineSavingsMsg'
Learn More
Learn More
FLJ23834 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
£258.00 - £451.00
Specifications
| Antigen | FLJ23834 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18435531
|
Novus Biologicals
NBP1-88100-25ul |
25 μL |
£258.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18715633
|
Novus Biologicals
NBP1-88100 |
£451.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||||
Description
FLJ23834 Polyclonal specifically detects FLJ23834 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| FLJ23834 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Cadherin-like protein 28, cadherin-related family member 3, CDH28MGC133292, FLJ23834, FLJ43271, FLJ44366, MGC133293 | |
| CDHR3 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 222256 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:LTQMPKWKESSHQGAAPRRVTAGEGMGSLRSANWEEDELSGKAWAEDAGLGSRNEGGKLGNPKNRNPAFMNRAYPKPHPGK | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title