missing translation for 'onlineSavingsMsg'
Learn More
Learn More
FLJ11506 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 4 publications
Brand: Novus Biologicals NBP1-87905
This item is not returnable.
View return policy
Description
FLJ11506 Polyclonal specifically detects FLJ11506 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| FLJ11506 | |
| Polyclonal | |
| Western Blot 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| alpha- and gamma-adaptin binding protein, alpha- and gamma-adaptin-binding protein p34, DKFZp667D2317, DKFZp686G08119, FLJ11506, p34 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| AAGAB | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:GGASNTTDAQVDSIVDPMLDLDIQELASLTTGGGDVENFERLFSKLKEMKDKAATLPHEQRKVHAEKVAKAFWMAIG | |
| 0.1 mL | |
| Signal Transduction | |
| 79719 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction