missing translation for 'onlineSavingsMsg'
Learn More

FLI1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Product Code. 18383687 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
25 μg
Unit Size:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18383687 100 μg 100µL
18303874 25 μg 25µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18383687 Supplier Novus Biologicals Supplier No. NBP317205100UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

FLI1 Polyclonal antibody specifically detects FLI1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen FLI1
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04 to 0.4 μg/mL, Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias EWSR2, Friend leukemia integration 1 transcription factor, Friend leukemia virus integration 1, Proto-oncogene Fli-1, SIC-1, Transcription factor ERGB
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: SYLRESSLLAYNTTSHTDQSSRLSVKEDPSYDSVRRGAWGNNMNSGLNKSPPLGGAQTISKNT
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Cancer, Tumor Suppressors
Primary or Secondary Primary
Gene ID (Entrez) 2313
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.