FLASH Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-58151

Product Code. 18245325

Description

FLASH Polyclonal specifically detects FLASH in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: FLASH
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: CASP8 associated protein 2, caspase 8 associated protein 2, CED-4, FLASHKIAA1315CASP8-associated protein 2, FLICE associated huge, FLICE-associated huge protein, FLJ11208, human FLASH, RIP25FLASH homolog RIP25
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: CASP8AP2
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:EKAQVANRPLKCIVEETYIDLTTESPSSCEVKKDELKSEPGSNCDNSELPGTLHNSHKKRRNISDLNHPHKKQRKETDLTNKEKTKKPTQDSCENTEAHQ
• Quantity: 100 μL
• Research Discipline: Apoptosis, Cancer, Tumor Suppressors
• Gene ID (Entrez): 9994
• Target Species: Human
• Isotype: IgG

For Research Use Only