missing translation for 'onlineSavingsMsg'
Learn More
Learn More
FKBP51/FKBP5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-84676-25ul
This item is not returnable.
View return policy
Description
FKBP51/FKBP5 Polyclonal specifically detects FKBP51/FKBP5 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| FKBP51/FKBP5 | |
| Polyclonal | |
| Western Blot 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| 51 kDa FKBP, 54 kDa progesterone receptor-associated immunophilin, AIG6,51 kDa FK506-binding protein, Androgen-regulated protein 6, FF1 antigen, FK506 binding protein 5, FK506-binding protein 5, FKBP-5, FKBP-51, FKBP51PPIase FKBP5, FKBP54EC 5.2.1.8, HSP90-binding immunophilin, MGC111006, p54, P54,51 kDa FK506-binding protein 5, peptidylprolyl cis-trans isomerase, peptidyl-prolyl cis-trans isomerase FKBP5, PPIase, Ptg-10, rotamase, T-cell FK506-binding protein | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of human FKBP51/FKBP5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| FKBP5 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:SAKGDFEKVLEVNPQNKAARLQISMCQKKAKEHNERDRRIYANMFKKFAEQDAKEEANKAMGKKTSEGVTNE | |
| 25 μL | |
| Cancer | |
| 2289 | |
| Human, Mouse, Rat | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction