missing translation for 'onlineSavingsMsg'
Learn More
Learn More
FKBP25 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-54354
This item is not returnable.
View return policy
Description
FKBP25 Polyclonal specifically detects FKBP25 in Human samples. It is validated for Western Blot.
Specifications
| FKBP25 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| EC 5.2.1.8,25 kDa FK506-binding protein, FK506 binding protein 3, 25kDa, FK506-binding protein 3, FK506-binding protein 3 (25kD), FKBP25,25 kDa FKBP, FKBP-3, Immunophilin FKBP25, peptidyl-prolyl cis-trans isomerase FKBP3, PPIase, PPIase FKBP3, rapamycin binding protein, Rapamycin-selective 25 kDa immunophilin, Rotamase, T-cell | |
| Rabbit | |
| 25 kDa | |
| 100 μL | |
| Stem Cell Markers | |
| 2287 | |
| Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish | |
| IgG |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| Q00688 | |
| FKBP3 | |
| Synthetic peptides corresponding to FKBP3(FK506 binding protein 3, 25kDa) The peptide sequence was selected from the C terminal of FKBP3. Peptide sequence EALLTMSKGEKARLEIEPEWAYGKKGQPDAKIPPNAKLTFEVELVDID. | |
| Affinity purified | |
| RUO | |
| Primary | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction