FKBP10 Antibody (3B5), Novus Biologicals™

Mouse Monoclonal Antibody

Brand:  Novus Biologicals H00060681-M02

Product Code. 18437969

Description

FKBP10 Monoclonal antibody specifically detects FKBP10 in Human samples. It is validated for Western Blot, ELISA, Sandwich ELISA

Specifications

• Antigen: FKBP10
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: In 1x PBS, pH 7.4
• Gene Alias: 65 kDa FK506-binding protein, 65 kDa FKBP, EC 5.2.1.8, FK506 binding protein 10 (65 kDa), FK506 binding protein 10, 65 kDa, FK506-binding protein 10, FKBP-10, FKBP6, FKBP-65, FKBP65PPIase FKBP10, FLJ20683, FLJ22041, FLJ23833, hFKBP65, Immunophilin FKBP65, OI6, peptidyl-prolyl cis-trans isomerase FKBP10, PPIASE, Rotamase
• Immunogen: FKBP10 (NP_068758, 377 a.a. ∽ 470 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ADVVEIRTLSRPSETCNETTKLGDFVRYHYNCSLLDGTQLFTSHDYGAPQEATLGANKVIEGLDTGLQGMCVGERRQLIVPPHLAHGESGARGV
• Quantity: 0.1 mg
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Western Blot, ELISA, Sandwich ELISA
• Clone: 3B5
• Dilution: Western Blot 1:500, ELISA, Sandwich ELISA
• Gene Accession No.: NP_068758
• Host Species: Mouse
• Purification Method: IgG purified
• Regulatory Status: RUO
• Gene ID (Entrez): 60681
• Content And Storage: Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
• Isotype: IgG2a κ