missing translation for 'onlineSavingsMsg'
Learn More
Learn More
FJX1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | FJX1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
FJX1 Polyclonal specifically detects FJX1 in Human samples. It is validated for Western Blot.Specifications
| FJX1 | |
| Polyclonal | |
| Rabbit | |
| Q86VR8 | |
| 24147 | |
| Synthetic peptides corresponding to FJX1(four jointed box 1 (Drosophila)) The peptide sequence was selected from the N terminal of FJX1. Peptide sequence MVALERGGCGRSSNRLARFADGTRACVRYGINPEQIQGEALSYYLARLLG. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| FLJ22416, FLJ25593, four jointed box 1 (Drosophila), four-jointed box protein 1, Four-jointed protein homolog, putative secreted ligand homologous to fjx1 | |
| FJX1 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title