missing translation for 'onlineSavingsMsg'
Learn More

Filaggrin family member 2 Antibody, Novus Biologicals™

Product Code. 18416281 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
25 μL
Unit Size:
25µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18416281 25 μL 25µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18416281 Supplier Novus Biologicals Supplier No. NBP19190125ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody has been used in 3 publications

Filaggrin family member 2 Polyclonal specifically detects Filaggrin family member 2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin, Proximity Ligation Assay.
TRUSTED_SUSTAINABILITY

Spécification

Antigen Filaggrin family member 2
Applications Immunohistochemistry, Immunohistochemistry (Paraffin), Proximity Ligation Assay
Classification Polyclonal
Concentration 0.05 mg/mL
Conjugate Unconjugated
Dilution Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50, Proximity Ligation Assay
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias filaggrin family member 2, filaggrin-2, FLG-2
Gene Symbols FLG2
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:CGYSNSSGCGRPQNASSSCQSHRFGGQGNQFSYIQSGCQSGIKGGQGHGCVSGGQPSGCGQPESNPCSQSYSQRGYGARENGQPQNCGGQWRTGSSQSSCCG
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 388698
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Afficher plus Afficher moins

For Research Use Only

Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.