FGFR1OP2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-84149

Product Code. 18260876

Description

FGFR1OP2 Polyclonal specifically detects FGFR1OP2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: FGFR1OP2
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: DKFZp564O1863, DKFZp586C1423, FGFR1 oncogene partner 2, fibroblast growth factor receptor 1 oncogene partner 2, FLJ37569, HSPC123-like, WIT3.0, wound inducible transcript 3.0
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: FGFR1OP2
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:NELQAHVDQITEMAAVMRKAIEIDEQQGCKEQERIFQLEQENKGLREILQITRESFLNLRKDDASESTSLSALVTNSD
• Quantity: 0.1 mL
• Research Discipline: Angiogenesis
• Gene ID (Entrez): 26127
• Target Species: Human
• Isotype: IgG

For Research Use Only