missing translation for 'onlineSavingsMsg'
Learn More
Learn More
FGFR1OP2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-84149
This item is not returnable.
View return policy
Description
FGFR1OP2 Polyclonal specifically detects FGFR1OP2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| FGFR1OP2 | |
| Polyclonal | |
| Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| DKFZp564O1863, DKFZp586C1423, FGFR1 oncogene partner 2, fibroblast growth factor receptor 1 oncogene partner 2, FLJ37569, HSPC123-like, WIT3.0, wound inducible transcript 3.0 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| FGFR1OP2 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:NELQAHVDQITEMAAVMRKAIEIDEQQGCKEQERIFQLEQENKGLREILQITRESFLNLRKDDASESTSLSALVTNSD | |
| 0.1 mL | |
| Angiogenesis | |
| 26127 | |
| Human | |
| IgG |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
For Research Use Only
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido