missing translation for 'onlineSavingsMsg'
Learn More
Learn More
FGFR1OP Antibody, Novus Biologicals™
Rabbit Monoclonal Antibody
£161.00 - £383.00
Specifications
| Antigen | FGFR1OP |
|---|---|
| Dilution | Western Blot 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 1:50 - 1:200 |
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence |
| Classification | Monoclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
30230158
|
Novus Biologicals
NBP3-33266-20ul |
20 μL |
£161.00
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30231236
|
Novus Biologicals
NBP3-33266-100ul |
100 μL |
£383.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
FGFR1OP Monoclonal antibody specifically detects FGFR1OP in Human,Mouse samples. It is validated for Western Blot,Immunocytochemistry/ImmunofluorescenceSpecifications
| FGFR1OP | |
| Western Blot, Immunocytochemistry/Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Angiogenesis, Apoptosis, Cell Cycle and Replication | |
| PBS (pH 7.3), 50% glycerol, 0.05% BSA | |
| 11116 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 1:50 - 1:200 | |
| Monoclonal | |
| Purified | |
| RUO | |
| Human, Mouse | |
| FGFR1 oncogene partner, FOPfibroblast growth factor receptor 1 oncogene partner | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 300-399 of human FGFR1OP (NP_008976.1).,, Sequence:, PSLKDSESKRGNTVLKDLKLISDKIGSLGLGTGEDDDYVDDFNSTSHRSEKSEISIGEEIEEDLSVEIDDINTSDKLDDLTQDLTVSQLSDVADYLEDVA | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title