FGFBP3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Marca:  Novus Biologicals NBP2-30824

Código de producto. 18121322

Descripción

FGFBP3 Polyclonal specifically detects FGFBP3 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Especificaciones

• Antigen: FGFBP3
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
• Gene Accession No.: Q8TAT2
• Gene Symbols: FGFBP3
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: AASNVAEPVPGPTGGSSGRFLSPEQHACSWQL
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: C10orf13, Chromosome 10 Open Reading Frame 13, FGF-Binding Protein 3, FGFBP3, FGF-BP3, FGFBP-3, Fibroblast Growth Factor-Binding Protein 3
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 143282
• Target Species: Human
• Isotype: IgG

For Research Use Only