missing translation for 'onlineSavingsMsg'
Learn More
Learn More
FGFBP2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£231.00 - £470.00
Specifications
| Antigen | FGFBP2 |
|---|---|
| Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18428820
|
Novus Biologicals
NBP1-81341-25ul |
25ul |
£231.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18247117
|
Novus Biologicals
NBP1-81341 |
0.1 mL |
£470.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
FGFBP2 Polyclonal specifically detects FGFBP2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| FGFBP2 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| 37 kDa killer-specific secretory protein, FGF-binding protein 2, FGF-BP2, FGFBP-2, fibroblast growth factor binding protein 2, fibroblast growth factor-binding protein 2, HBp17-RP, HBP17RP, killer-specific secretory protein of 37 kDa, Ksp37, KSP37HBp17-related protein | |
| FGFBP2 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Rabbit | |
| Angiogenesis | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 83888 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:PVLRPSVCREAGPQAHMQQVTSSLKGSPEPNQQPEAGTPSLRPKATVKLTEATQLGKDSMEELGKAKPTTR | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title