missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. FGF basic/FGF2/bFGF Rabbit anti-Human, Mouse, Rat, Clone: 8W6M5, Novus Biologicals™

FGF basic/FGF2/bFGF Rabbit anti-Human, Mouse, Rat, Clone: 8W6M5, Novus Biologicals™

Product Code. 18361674 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
20 μg
Unit Size:
100µL
20µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18361674 100 μg 100µL
18390892 20 μg 20µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18361674 Supplier Novus Biologicals Supplier No. NBP315367100UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Monoclonal Antibody

FGF basic/FGF2/bFGF Monoclonal antibody specifically detects FGF basic/FGF2/bFGF in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), KnockDown
TRUSTED_SUSTAINABILITY

Specifications

Antigen FGF basic/FGF2/bFGF
Applications Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), KnockDown
Classification Monoclonal
Clone 8W6M5
Conjugate Unconjugated
Dilution Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin, Knockout Validated
Formulation PBS, 0.05% BSA, 50% glycerol, pH7.3
Gene Alias Basic fibroblast growth factor, basic fibroblast growth factor bFGF, bFGF, FGFBprostatropin, fibroblast growth factor 2 (basic), HBGF-2, heparin-binding growth factor 2
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human FGF basic/FGF2/bFGF (NP_001997.5). RAPERVGGRGRGRGTAAPRAAPAARGSRPGPAGTMAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAE
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Angiogenesis, Biologically Active Proteins, Cancer
Primary or Secondary Primary
Gene ID (Entrez) 2247
Target Species Human, Mouse, Rat
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.