missing translation for 'onlineSavingsMsg'
Learn More

FGF-8 Antibody (2A11), Novus Biologicals™

Product Code. 18385448 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18385448 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18385448 Supplier Novus Biologicals Supplier No. H00002253M05

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Monoclonal Antibody

FGF-8 Monoclonal antibody specifically detects FGF-8 in Human samples. It is validated for ELISA, Proximity Ligation Assay, ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen FGF-8
Applications ELISA, Proximity Ligation Assay, Sandwich ELISA
Classification Monoclonal
Clone 2A11
Conjugate Unconjugated
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_149354
Gene Alias AIGFKAL6, Androgen-induced growth factor, FGF-8, fibroblast growth factor 8, fibroblast growth factor 8 (androgen-induced), HBGF-8, Heparin-binding growth factor 8, MGC149376
Host Species Mouse
Immunogen FGF8 (NP_149354, 65 a.a. ~ 133 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSR VRVRGAETGLYICMNKKGK
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Angiogenesis, Cell Cycle and Replication
Primary or Secondary Primary
Gene ID (Entrez) 2253
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.