missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
FGF-8 Monoclonal antibody specifically detects FGF-8 in Human samples. It is validated for ELISA, Proximity Ligation Assay, ELISA
Specifications
Specifications
| Antigen | FGF-8 |
| Applications | ELISA, Proximity Ligation Assay, Sandwich ELISA |
| Classification | Monoclonal |
| Clone | 2A11 |
| Conjugate | Unconjugated |
| Formulation | In 1x PBS, pH 7.4 |
| Gene Accession No. | NP_149354 |
| Gene Alias | AIGFKAL6, Androgen-induced growth factor, FGF-8, fibroblast growth factor 8, fibroblast growth factor 8 (androgen-induced), HBGF-8, Heparin-binding growth factor 8, MGC149376 |
| Host Species | Mouse |
| Immunogen | FGF8 (NP_149354, 65 a.a. ~ 133 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSR VRVRGAETGLYICMNKKGK |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?