missing translation for 'onlineSavingsMsg'
Learn More
Learn More
FGF-3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | FGF-3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
FGF-3 Polyclonal specifically detects FGF-3 in Rat samples. It is validated for Western Blot.Specifications
| FGF-3 | |
| Polyclonal | |
| Rabbit | |
| NP_570830 | |
| 2248 | |
| Synthetic peptide directed towards the C terminal of human Fgf3. Peptide sequence KGRPRRGFKTRRTQKSSLFLPRVLGHKDHEMVRLLQSGQPQAPGEGSQPR. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| fibroblast growth factor 3, fibroblast growth factor 3 (murine mammary tumor virus integration site (v-int-2) oncogene homolog), HBGF-3, mouse, oncogene INT2 | |
| FGF3 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title