missing translation for 'onlineSavingsMsg'
Learn More
Learn More
FGF-11 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | FGF-11 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
FGF-11 Polyclonal specifically detects FGF-11 in Human samples. It is validated for Western Blot.Specifications
| FGF-11 | |
| Polyclonal | |
| Rabbit | |
| Angiogenesis, Neuroscience | |
| FGF-11, FHF-3, FHF3Fibroblast growth factor homologous factor 3, fibroblast growth factor 11, FLJ16061, MGC102953, MGC45269 | |
| FGF11 | |
| IgG | |
| 25 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q92914 | |
| 2256 | |
| Synthetic peptides corresponding to FGF11 (fibroblast growth factor 11) The peptide sequence was selected from the N terminal of FGF11. Peptide sequence VTKLFCRQGFYLQANPDGSIQGTPEDTSSFTHFNLIPVGLRVVTIQSAKL. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title