missing translation for 'onlineSavingsMsg'
Learn More
Learn More
FFAR4/GPR120 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£222.00 - £513.00
Specifications
| Antigen | FFAR4/GPR120 |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:10 - 1:20 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18424821
|
Novus Biologicals
NBP1-89739-25ul |
25 μL |
£222.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18252478
|
Novus Biologicals
NBP1-89739 |
0.1 mL |
£513.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
FFAR4/GPR120 Polyclonal specifically detects FFAR4/GPR120 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| FFAR4/GPR120 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| Q5NUL3 | |
| 338557 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:FRVVPQRLPGADQEISICTLIWPTIPGEISWDV | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:10 - 1:20 | |
| Polyclonal | |
| Rabbit | |
| GPCR | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| G protein-coupled receptor 120, G protein-coupled receptor 129, G protein-coupled receptor PGR4, GPR120, GPR129, G-protein coupled receptor 120, G-protein coupled receptor 129, G-protein coupled receptor GT01, G-protein coupled receptor PGR4, G-protein-coupled receptor GT01, GT01, MGC119984, omega-3 fatty acid receptor 1, PGR4DKFZp686F0824 | |
| FFAR4 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title