missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Ferritin Heavy Chain Antibody, Novus Biologicals™
Rabbit Monoclonal Antibody
Brand: Novus Biologicals NBP3-33362-100ul
This item is not returnable.
View return policy
Description
Ferritin Heavy Chain Monoclonal antibody specifically detects Ferritin Heavy Chain in Human samples. It is validated for ELISA,Immunohistochemistry,Immunohistochemistry (Paraffin)
Specifications
| Ferritin Heavy Chain | |
| Monoclonal | |
| ELISA Recommended starting concentration is 1 μg/mL, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| apoferritin, Cell proliferation-inducing gene 15 protein, Ferritin H subunit, ferritin heavy chain, ferritin, heavy polypeptide 1, FHC, FTHEC 1.16.3.1, FTHL6MGC104426, PIG15, placenta immunoregulatory factor, PLIF, proliferation-inducing protein 15 | |
| A synthetic peptide corresponding to a sequence within amino acids 84-183 of human Ferritin Heavy Chain (P02794).,, Sequence:, QDIKKPDCDDWESGLNAMECALHLEKNVNQSLLELHKLATDKNDPHLCDFIETHYLNEQVKAIKELGDHVTNLRKMGAPESGLAEYLFDKHTLGDSDNES | |
| 100 μL | |
| Lipid and Metabolism | |
| 2495 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol, 0.05% BSA | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction