FENS1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Product Code	Brand	Quantity
18434722	Novus Biologicals NBP2-13521-25ul	25ul
18066309	Novus Biologicals NBP2-13521	0.1 mL

Description

FENS1 Polyclonal specifically detects FENS1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: FENS1
• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 57590
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: SIYHTMASPCSAMAYHHDSRRIFVGQDNGAVMEFHVSEDFNKMNFIKTYPAHQNRVSAIIFSLATEWVISTGH
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human
• Gene Alias: FENS-1Zinc finger FYVE domain-containing protein 17, KIAA1435, Phosphoinositide-binding protein 1, WD repeat and FYVE domain containing 1, WD repeat and FYVE domain-containing protein 1, WD40 and FYVE domain containing 1, WDF1WD40- and FYVE domain-containing protein 1, ZFYVE17phosphoinositide-binding protein SR1
• Gene Symbols: WDFY1
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only