FCRL4/FcRH4/IRTA1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-69383

Product Code. 18272843

Description

FCRL4/FcRH4/IRTA1 Polyclonal specifically detects FCRL4/FcRH4/IRTA1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: FCRL4/FcRH4/IRTA1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: CD307d antigen, Fc receptor homolog 4, Fc receptor-like 4, FcRH4, FCRH4Fc receptor-like protein 4, FcRL4, FcR-like protein 4, hIFGP2, IFGP family protein 2, IFGP2, IGFP2, Immune receptor translocation-associated protein 1, immunoglobulin superfamily Fc receptor, gp42, immunoglobulin superfamily receptor translocation associated 1, IRTA1MGC150523, MGC150522
• Host Species: Rabbit
• Molecular Weight of Antigen: 57 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Porcine: 85%.
• Target Species: Human, Pig
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q96PJ5
• Gene Symbols: FCRL4
• Immunogen: Synthetic peptides corresponding to FCRL4(Fc receptor-like 4) The peptide sequence was selected from the N terminal of FCRL4. Peptide sequence FKGERVTLTCNGFQFYATEKTTWYHRHYWGEKLTLTPGNTLEVRESGLYR.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 83417
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only