FCGR2C Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Product Code	Brand	Quantity
18396634	Novus Biologicals NBP3-09539-100UL	100 μg

Description

FCGR2C Polyclonal specifically detects FCGR2C in Human samples. It is validated for Western Blot.

Specifications

• Antigen: FCGR2C
• Applications: Western Blot
• Conjugate: Unconjugated
• Host Species: Rabbit
• Target Species: Human
• Gene Alias: low affinity immunoglobulin gamma Fc region receptor II-c, CD32, CD32C, CDW32, Fc fragment of IgG, low affinity IIc, receptor for (CD32) (gene/pseudogene), FCG2, FCRIIC, IGFR2
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human FCGR2C (NP_963857). Peptide sequence GTHSPESDSIPWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSD
• Purification Method: Affinity purified

• Dilution: Western Blot 1.0 ug/ml
• Classification: Polyclonal
• Form: Purified
• Regulatory Status: RUO
• Formulation: PBS buffer, 2% sucrose
• Gene ID (Entrez): 9103
• Primary or Secondary: Primary
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.