missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18349737

Fc epsilon RI beta/MS4A2 Antibody, Novus Biologicals™

Product Code. 18349737 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18349737 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18349737 Supplier Novus Biologicals Supplier No. H00002206D01P

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

Fc epsilon RI beta/MS4A2 Polyclonal antibody specifically detects Fc epsilon RI beta/MS4A2 in Human samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen Fc epsilon RI beta/MS4A2
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Formulation PBS (pH 7.4)
Gene Accession No. NP_000130.1
Gene Alias APY, ATOPY, Fc epsilon receptor I beta-chain, FCER1BIGEL, FCERI, High affinity immunoglobulin epsilon receptor beta-subunit (FcERI) (IgE Fcreceptor, beta-subunit) (Fc epsilon receptor I beta-chain), high affinity immunoglobulin epsilon receptor subunit beta, IgE Fc receptor subunit beta, IgE responsiveness (atopic), IGER, IGHER, immunoglobulin E receptor, high affinity, beta polypeptide, Membrane-spanning 4-domains subfamily A member 2, membrane-spanning 4-domains, subfamily A, member 2 (Fc fragment of IgE, highaffinity I, receptor for, beta polypeptide), MS4A1
Host Species Rabbit
Immunogen MS4A2 (NP_000130.1, 1 a.a. - 244 a.a.) full-length human protein. MDTESNRRANLALPQEPSSVPAFEVLEISPQEVSSGRLLKSASSPPLHTWLTVLKKEQEFLGVTQILTAMICLCFGTVVCSVLDISHIEGDIFSSFKAGYPFWGAIFFSISGMLSIISERRNATYLVRGSLGANTASSIAGGTGITILIINLKKSLAYIHIHSCQKFFETKCFMASFSTEIVVMMLFLTILGLGSAVSLTICGAGEELKGNKVPEDRVYEELNIYSATYSELEDPGEMSPPIDL
Purification Method Protein A purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Asthma, Immunology, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 2206
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.