FBXW8 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-38429-25ul

Product Code. 18643626

Description

FBXW8 Polyclonal specifically detects FBXW8 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: FBXW8
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Accession No.: Q8N3Y1
• Gene Symbols: FBXW8
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: EDGFLNIWDLRTGKYPVHRFEHDARIQALALSQDDATVATASAFDVVMLSPNEEGYWQIAAEFEVPKLVQYLEIVPETRRYPVAVAAAGDLMYLLKA
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: F-box and WD repeat domain containing 8, F-box only protein 29F-box/WD repeat-containing protein 8, FBW8F-box and WD-40 domain-containing protein 8, FBX29MGC33534, FBXO29, FBXW6FBW6F-box and WD-40 domain protein 8
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 26259
• Target Species: Human
• Isotype: IgG