missing translation for 'onlineSavingsMsg'
Learn More
Learn More
FBXO39 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£362.00
Specifications
| Antigen | FBXO39 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Beschreibung
FBXO39 Polyclonal specifically detects FBXO39 in Human samples. It is validated for Western Blot.Spezifikation
| FBXO39 | |
| Polyclonal | |
| Rabbit | |
| Q8N4B4 | |
| 162517 | |
| Synthetic peptides corresponding to FBXO39(F-box protein 39) The peptide sequence was selected from the N terminal of FBXO39. Peptide sequence DRSRAALVCRKWNQMMYSAELWRYRTITFSGRPSRVHASEVESAVWYVKK. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| F-box only protein 39, F-box protein 39, Fbx39, FLJ18190, FLJ98753, MGC35179 | |
| FBXO39 | |
| IgG |
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts