missing translation for 'onlineSavingsMsg'
Learn More
Learn More
FBXO34 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | FBXO34 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
FBXO34 Polyclonal specifically detects FBXO34 in Human samples. It is validated for Western Blot.Specifications
| FBXO34 | |
| Polyclonal | |
| Rabbit | |
| Q9NWN3 | |
| 55030 | |
| Synthetic peptides corresponding to FBXO34(F-box protein 34) The peptide sequence was selected from the middle region of FBXO34. Peptide sequence ESECLKRQGQREPGSLSRNNSFRRNVGRVLLANSTQADEGKTKKGVLEAP. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| DKFZp547C162, F-box only protein 34, F-box protein 34, FBX34, FLJ20725, MGC126434, MGC126435, protein CGI-301 | |
| FBXO34 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title