missing translation for 'onlineSavingsMsg'
Learn More
Learn More
FBXO27 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | FBXO27 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
FBXO27 Polyclonal specifically detects FBXO27 in Human samples. It is validated for Western Blot.Specifications
| FBXO27 | |
| Polyclonal | |
| Rabbit | |
| Q8NI29 | |
| 126433 | |
| Synthetic peptides corresponding to FBXO27(F-box protein 27) The peptide sequence was selected from the middle region of FBXO27. Peptide sequence LDKFSAVPDPIPQWNNNACLHVTHVFSNIKMGVRFVSFEHRGQDTQFWAG. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Fbg5, FBG5FBX27, F-box only protein 27, F-box protein 27, F-box protein FBG5, F-box/G-domain protein 5, Fbx27 | |
| FBXO27 | |
| IgG | |
| 31 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title