missing translation for 'onlineSavingsMsg'
Learn More
Learn More
FBXO25 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£362.00
Specifications
| Antigen | FBXO25 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
FBXO25 Polyclonal specifically detects FBXO25 in Human samples. It is validated for Western Blot.Specifications
| FBXO25 | |
| Polyclonal | |
| Rabbit | |
| Q8TCJ0 | |
| 26260 | |
| Synthetic peptides corresponding to FBXO25(F-box protein 25) The peptide sequence was selected from the N terminal of FBXO25. Peptide sequence LGEAFNRLDFSSAIQDIRRFNYVVKLLQLIAKSQLTSLSGVAQKNYFNIL. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| F-box protein 25, F-box protein Fbx25, FBX25F-box only protein 25, MGC20256, MGC51975 | |
| FBXO25 | |
| IgG | |
| 34 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title