missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. FBXO2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

FBXO2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Product Code. 18327164 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
25 μg
Unit Size:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18327164 25 μg 25µL
18366694 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18327164 Supplier Novus Biologicals Supplier No. NBP31056525UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

FBXO2 Polyclonal specifically detects FBXO2 in Human samples. It is validated for Western Blot.
TRUSTED_SUSTAINABILITY

Spécification

Antigen FBXO2
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS buffer, 2% sucrose
Gene Alias FBG1, F-box gene 1, F-box only protein 2, F-box protein 2, Fbs1, FBX2Fbg1, Nfb42, OCP1, organ of Corti protein 1
Host Species Rabbit
Immunogen The immunogen is a synthetic peptide directed towards the middle region of Human FBXO2 (NP_036300). Peptide sequence HGGDGWRVEELPGDSGVEFTHDESVKKYFASSFEWCRKAQVIDLQAEGYW
Purification Method Affinity purified
Quantity 25 μg
Regulatory Status RUO
Research Discipline Cell Biology, Ubiquitin Proteasome Pathway
Primary or Secondary Primary
Gene ID (Entrez) 26232
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Afficher plus Afficher moins
Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.