missing translation for 'onlineSavingsMsg'
Learn More
Learn More
FATE1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | FATE1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
FATE1 Polyclonal specifically detects FATE1 in Human samples. It is validated for Western Blot.Specifications
| FATE1 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Cancer/testis antigen 43, CT43BJ-HCC-2 antigen, FATEfetal and adult testis expressed transcript protein, fetal and adult testis expressed 1, fetal and adult testis-expressed transcript protein, Tumor antigen BJ-HCC-2 | |
| FATE1 | |
| IgG | |
| 21 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_149076 | |
| 89885 | |
| Synthetic peptide directed towards the N terminal of human FATE1The immunogen for this antibody is FATE1. Peptide sequence PNTKAEMEMSLAEELNHGRQGENQEHLVIAEMMELGSRSRGASQKKQKLE. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title