missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. FAT10 Rabbit anti-Human, Mouse, Rat, Clone: 10A6T5, Novus Biologicals™

FAT10 Rabbit anti-Human, Mouse, Rat, Clone: 10A6T5, Novus Biologicals™

Product Code. 18330553
Change view
Click to view available options
Quantity:
100 μg
20 μg
Unit Size:
100µL
20µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18330553 20 μg 20µL
18371435 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18330553 Supplier Bio-Techne Supplier No. NBP31673120UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Monoclonal Antibody

FAT10 Monoclonal antibody specifically detects FAT10 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen FAT10
Applications Western Blot, Immunofluorescence
Classification Monoclonal
Clone 10A6T5
Conjugate Unconjugated
Dilution Western Blot 1:500 - 1:2000, Immunocytochemistry/Immunofluorescence 1:50 - 1:200
Formulation PBS, 0.05% BSA, 50% glycerol, pH7.3
Gene Alias Diubiquitin, FAT10diubiquitin, GABBR1, UBD-3, ubiquitin D, Ubiquitin-like protein FAT10
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 70-150 of human FAT10 (O15205). KEKTIHLTLKVVKPSDEELPLFLVESGDEAKRHLLQVRRSSSVAQVKAMIETKTGIIPETQIVTCNGKRLEDGKMMADYGI
Purification Method Affinity purified
Quantity 20 μg
Regulatory Status RUO
Research Discipline Cell Biology, Immunology
Primary or Secondary Primary
Gene ID (Entrez) 10537
Target Species Human, Mouse, Rat
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.