missing translation for 'onlineSavingsMsg'
Learn More

Fascin 2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Product Code. 18360874 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
25 μg
Unit Size:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18360874 25 μg 25µL
18348136 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18360874 Supplier Novus Biologicals Supplier No. NBP31736825UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

Fascin 2 Polyclonal antibody specifically detects Fascin 2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen Fascin 2
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias fascin homolog 2, actin-bundling protein, retinal (Strongylocentrotuspurpuratus), fascin-2, Retinal fascin, retinal), RFSNRP30fascin (Strongylocentrotus purpuratus) homolog 2 (actin-bundling protein
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: HRYVSVRQGVNVSANQDDELDHETFLMQIDQETKKCTFYSSTGGYWTLVTHGGIHATATQVSANTMFEMEWRG
Purification Method Affinity purified
Quantity 25 μg
Regulatory Status RUO
Research Discipline Cell Biology, Cytoskeleton Markers, Neuroscience, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 25794
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.