missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Biochemical Reagents
  4. Peptides
  5. 18343361

Novus Biologicals™ Fas/TNFRSF6/CD95 Recombinant Protein Antigen

Product Code. 18343361 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.1mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18343361 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18343361 Supplier Novus Biologicals™ Supplier No. NBP189034PEP

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FAS. The Fas/TNFRSF6/CD95 Recombinant Protein Antigen is derived from E. coli. The Fas/TNFRSF6/CD95 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

This is a blocking peptide for NBP1-89034. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.

TRUSTED_SUSTAINABILITY

Specifications

Gene ID (Entrez) 355
Species Human
Purification Method Chromatography
Purity >80%
Concentration 0.5mg/mL
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Formulation PBS and 1M Urea, pH 7.4.
For Use With (Application) Blocking/Neutralizing, Control
Gene Alias ALPS1A, Apo-1, APO-1 cell surface antigen, apoptosis antigen 1, apoptosis signaling receptor FAS, Apoptosis-mediating surface antigen FAS, APT1, CD95, CD95 antigen, Fas (TNF receptor superfamily, member 6), Fas AMA, FAS1, FASLG receptor, FASTM, mutant tumor necrosis receptor superfamily member 6, TNF receptor superfamily member 6, TNFRSF6, tumor necrosis factor receptor superfamily member 6, tumor necrosis factor receptor superfamily, member 6
Gene Symbol FAS
Label Type Unlabeled
Molecular Weight (g/mol) 25kDa
Product Type Fas/TNFRSF6/CD95
Quantity 0.1 mL
Regulatory Status RUO
Research Category Apoptosis, Cancer, Cell Biology, Death Receptor Signaling Pathway, Diabetes Research, Hematopoietic Stem Cell Markers, Immunology, Inhibitors Activators and Regulators, Innate Immunity, Signal Transduction, Stem Cells
Source E.Coli
Specific Reactivity This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89034. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Immunogen QVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAH
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.