missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Fas/TNFRSF6/CD95 Antibody, Novus Biologicals™

Fas/TNFRSF6/CD95 Antibody, Novus Biologicals™

Product Code. 18400861 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
25 μL
Unit Size:
0.1mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18400861 25 μL 25µL
18780234 - 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18400861 Supplier Novus Biologicals Supplier No. NBP18903425ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody has been used in 1 publication

Fas Receptor/TNFRSF6/CD95 Polyclonal specifically detects Fas Receptor/TNFRSF6/CD95 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifications

Antigen Fas Receptor/TNFRSF6/CD95
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias ALPS1A, Apo-1, APO-1 cell surface antigen, apoptosis antigen 1, apoptosis signaling receptor FAS, Apoptosis-mediating surface antigen FAS, APT1, CD95, CD95 antigen, Fas (TNF receptor superfamily, member 6), Fas AMA, FAS1, FASLG receptor, FASTM, mutant tum
Gene Symbols FAS
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:QVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAH
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Apoptosis, Cancer, Cell Biology, Death Receptor Signaling Pathway, Diabetes Research, Hematopoietic Stem Cell Markers, Immunology, Inhibitors Activators and Regulators, Innate Immunity, Signal Transduction, Stem Cells
Primary or Secondary Primary
Gene ID (Entrez) 355
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.