missing translation for 'onlineSavingsMsg'
Learn More

Novus Biologicals™ FARP2 Recombinant Protein Antigen

Product Code. 18294549 Shop All Bio Techne Products
Click to view available options
Quantity:
0.1mL
Unit Size:
0.10mL
This item is not returnable. View return policy

Product Code. 18294549

Brand: Novus Biologicals™ NBP184680PEP

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FARP2. The FARP2 Recombinant Protein Antigen is derived from E. coli. The FARP2 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

This is a blocking peptide for NBP1-84680. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.

TRUSTED_SUSTAINABILITY

Specifications

Gene ID (Entrez) 9855
Species Human
Purification Method Chromatography
Purity >80%
Concentration 0.5mg/mL
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Formulation PBS and 1M Urea, pH 7.4.
For Use With (Application) Blocking/Neutralizing, Control
Gene Symbol FARP2
Label Type Unlabeled
Molecular Weight (g/mol) 26kDa
Product Type FARP2
Quantity 0.1mL
Regulatory Status RUO
Source E.Coli
Specific Reactivity This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84680. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Immunogen EIEGTYRVLQTAGMRLGAQTPVGVSTLEPGQTLLPRMQEKHLHLRVKLLDNTMEIFDIEPKCDGQVLLTQVWKRLNL
Mostrar más Mostrar menos

For Research Use Only

Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado