missing translation for 'onlineSavingsMsg'
Learn More
Learn More
FANCD2OS Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-17491-100UL
This item is not returnable.
View return policy
Description
FANCD2OS Polyclonal antibody specifically detects FANCD2OS in Human samples. It is validated for Immunofluorescence
Specifications
| FANCD2OS | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL | |
| C3orf24, chromosome 3 open reading frame 24, fancd2 opposite strand, hypothetical protein LOC115795, RGD1565997 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: WTPLDESFQWLRHTTPTPSSKHPFKASPCFPHTPSDLEVQLCFQEVTLVLDSPFLESGVSPKLPCHTSELRTMNNKGLVRK | |
| 100 μg | |
| Primary | |
| Human | |
| Purified |
| Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 115795 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Hittar du en möjlighet till förbättring?Dela en innehållskorrigering