missing translation for 'onlineSavingsMsg'
Learn More

FANCD2OS Rabbit anti-Human, Polyclonal, Novus Biologicals™

Product Code. 18342113 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
25 μg
Unit Size:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18342113 25 μg 25µL
18322702 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18342113 Supplier Novus Biologicals Supplier No. NBP31749125UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

FANCD2OS Polyclonal antibody specifically detects FANCD2OS in Human samples. It is validated for Immunofluorescence
TRUSTED_SUSTAINABILITY

Especificaciones

Antigen FANCD2OS
Applications Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias C3orf24, chromosome 3 open reading frame 24, fancd2 opposite strand, hypothetical protein LOC115795, RGD1565997
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: WTPLDESFQWLRHTTPTPSSKHPFKASPCFPHTPSDLEVQLCFQEVTLVLDSPFLESGVSPKLPCHTSELRTMNNKGLVRK
Purification Method Affinity purified
Quantity 25 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 115795
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.