missing translation for 'onlineSavingsMsg'
Learn More
Learn More
FAM92B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£390.00
Specifications
| Antigen | FAM92B |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
FAM92B Polyclonal specifically detects FAM92B in Human samples. It is validated for Western Blot.Specifications
| FAM92B | |
| Polyclonal | |
| Rabbit | |
| Q6ZTR7 | |
| 339145 | |
| Synthetic peptides corresponding to FAM92B(family with sequence similarity 92, member B) The peptide sequence was selected from the N terminal of FAM92B. Peptide sequence FAEDLAKVQDYRQAQVERLETKVVNPLKLYGAQIKQTRAEIKKFKHVQNH. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| family with sequence similarity 92, member B, FLJ44299, hypothetical protein LOC339145, MGC138149 | |
| FAM92B | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title