missing translation for 'onlineSavingsMsg'
Learn More
Learn More
FAM78B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | FAM78B |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
FAM78B Polyclonal specifically detects FAM78B in Human samples. It is validated for Western Blot.Specifications
| FAM78B | |
| Polyclonal | |
| Rabbit | |
| Q5VT40 | |
| 149297 | |
| Synthetic peptides corresponding to FAM78B(family with sequence similarity 78, member B) The peptide sequence was selected from the middle region of FAM78B. Peptide sequence PSVTWAVPVSDSNVPLLTRIKRDQSFTTWLVAMNTTTKEKIILQTIKWRM. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| family with sequence similarity 78, member B, hypothetical protein LOC149297, MGC131653 | |
| FAM78B | |
| IgG | |
| 30 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title