missing translation for 'onlineSavingsMsg'
Learn More
Learn More
FAM78A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | FAM78A |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
FAM78A Polyclonal specifically detects FAM78A in Human samples. It is validated for Western Blot.Specifications
| FAM78A | |
| Polyclonal | |
| Rabbit | |
| Q5JUQ0 | |
| 286336 | |
| Synthetic peptides corresponding to FAM78A(family with sequence similarity 78, member A) The peptide sequence was selected from the N terminal of FAM78A. Peptide sequence MPGFFCDCWPSLEIRALLYAMGCIQSIGGKARVFREGITVIDVKASIDPV. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| C9orf59, chromosome 9 open reading frame 59, family with sequence similarity 78, member A, FLJ00024, hypothetical protein LOC286336 | |
| FAM78A | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title