FAM53C Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-55381

Product Code. 18243445

Description

FAM53C Polyclonal specifically detects FAM53C in Human samples. It is validated for Western Blot.

Specifications

• Antigen: FAM53C
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: C5orf6, chromosome 5 open reading frame 6, family with sequence similarity 53, member C, hypothetical protein LOC51307, putative nuclear protein
• Host Species: Rabbit
• Molecular Weight of Antigen: 43 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9NYF3
• Gene Symbols: FAM53C
• Immunogen: Synthetic peptides corresponding to FAM53C(family with sequence similarity 53, member C) Antibody(against the N terminal of FAM53C. Peptide sequence SNCGNSFQLVSEGASWRGLPHCSCAEFQDSLNFSYHPSGLSLHLRPPSRG.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 51307
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG