missing translation for 'onlineSavingsMsg'
Learn More
Learn More
FAM35A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£390.00
Specifications
| Antigen | FAM35A |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
FAM35A Polyclonal specifically detects FAM35A in Human samples. It is validated for Western Blot.Specifications
| FAM35A | |
| Polyclonal | |
| Rabbit | |
| Human | |
| bA163M19.1, FAM35A1, family with sequence similarity 35, member A, hypothetical protein LOC54537, MGC5560 | |
| FAM35A | |
| IgG | |
| 94 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q86V20 | |
| 54537 | |
| Synthetic peptides corresponding to FAM35A(family with sequence similarity 35, member A) Antibody(against the N terminal of FAM35A. Peptide sequence PDLSGHFLANCMNRHVHVKDDFVRSVSETQNIESQKIHSSRLSDITSSNM. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title