missing translation for 'onlineSavingsMsg'
Learn More
Learn More
FAM21A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marke: Novus Biologicals NBP2-68768-25ul
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
FAM21A Polyclonal antibody specifically detects FAM21A in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Spezifikation
| FAM21A | |
| Polyclonal | |
| Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| Alternative Protein FAM21B, BA56A21.1, bA98I6.1, FAM21B, Family With Sequence Similarity 21 Member A, Family With Sequence Similarity 21, Member A, Family With Sequence Similarity 21, Member B, WASH Complex Subunit FAM21A, WASH Complex Subunit FAM21B | |
| This antibody was developed against a recombinant protein corresponding to amino acids: GIQAKTTKPKSRSAQAAPEPRFEHKVSNIFDDPLNAFGGQ | |
| 25 μL | |
| Primary | |
| Human | |
| Purified |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Protein A purified | |
| RUO | |
| 387680 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur