missing translation for 'onlineSavingsMsg'
Learn More
Learn More
FAM190A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | FAM190A |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
FAM190A Polyclonal specifically detects FAM190A in Human samples. It is validated for Western Blot.Specifications
| FAM190A | |
| Polyclonal | |
| Rabbit | |
| Q9C0I3-2 | |
| 401145 | |
| Synthetic peptides corresponding to MGC48628(similar to KIAA1680 protein) The peptide sequence was selected from the N terminal of MGC48628. Peptide sequence HHKKGSEPKQEPTNQNLSISNGAQPGHSNMQKLSLEEHIKTRGRHSVGFS. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| family with sequence similarity 190, member A, KIAA1680 protein, KIAA1680MGC48628 | |
| CCSER1 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title