missing translation for 'onlineSavingsMsg'
Learn More
Learn More
FAM184A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-58994
This item is not returnable.
View return policy
Description
FAM184A Polyclonal specifically detects FAM184A in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.
Specifications
| FAM184A | |
| Polyclonal | |
| Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml | |
| C6orf60, chromosome 6 open reading frame 60, family with sequence similarity 184, member A, FLJ13942, hypothetical protein LOC79632 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 79632 | |
| Human | |
| IgG |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| FAM184A | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KVNEAKRTQQEYYERELKNLQSRLEEEVTQLNEAHSKTLEELAWKHHMAIEAVHSNAIRDKKKLQMDLEEQHNKDKLNLE | |
| 100 μL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction