missing translation for 'onlineSavingsMsg'
Learn More
Learn More
FAM153B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£362.00
Specifications
| Antigen | FAM153B |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
FAM153B Polyclonal specifically detects FAM153B in Human samples. It is validated for Western Blot.Specifications
| FAM153B | |
| Polyclonal | |
| Rabbit | |
| Human | |
| 202134 | |
| Synthetic peptide directed towards the middle region of human LOC202134. Peptide sequence: GDLEDLEEHVPGQTVSEEATGVHMMQVDPATPAKSDLEDLEEHVPGQTVS | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| DKFZp434D115, family with sequence similarity 153, member B | |
| FAM153B | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title