missing translation for 'onlineSavingsMsg'
Learn More
Learn More
FAM135B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | FAM135B |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
FAM135B Polyclonal specifically detects FAM135B in Human samples. It is validated for Western Blot.Specifications
| FAM135B | |
| Polyclonal | |
| Rabbit | |
| NP_056996 | |
| 51059 | |
| Synthetic peptide directed towards the middle region of human FAM135BThe immunogen for this antibody is FAM135B. Peptide sequence TLVSTGLWLMQKLKKSGSLLQLTFRDNADLRKCFLYQLSQKTGLQYFKNV. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| family with sequence similarity 135, member B, MGC126009 | |
| FAM135B | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title