missing translation for 'onlineSavingsMsg'
Learn More
Learn More
FAM131C Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | FAM131C |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
FAM131C Polyclonal specifically detects FAM131C in Human samples. It is validated for Western Blot.Specifications
| FAM131C | |
| Polyclonal | |
| Rabbit | |
| NP_872429 | |
| 348487 | |
| Synthetic peptide directed towards the middle region of human FAM131CThe immunogen for this antibody is FAM131C. Peptide sequence RGRVAHLIEWKGWSAQPAGWELSPAEDEHYCCLPDELREARFAAGVAEQF. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| C1orf117, family with sequence similarity 131, member C, FLJ36766, hypothetical protein LOC348487, RP11-5P18.9 | |
| FAM131C | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title