FAM12A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Product Code	Brand	Quantity
18460282	Novus Biologicals NBP2-13945-25ul	25ul
18019967	Novus Biologicals NBP2-13945	0.1 mL

Description

FAM12A Polyclonal specifically detects FAM12A in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: FAM12A
• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 10876
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: KEALKGKSFHMFIYSLWFKIQRACINEKGSDRYRNAYVWAPGALKVLECHWEKYNNRYTESRSFS
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human
• Gene Alias: EP3A, epididymal protein 3A, epididymal secretory protein E3-alpha, epididymis-specific 3 alpha, FAM12AMGC119615, family with sequence similarity 12, member A, HE3Aepididymal secretory protein E3 alpha, HE3-alpha, HE3ALPHA, human epididymis-specific 3 alpha, Human epididymis-specific protein 3-alpha, MGC119614
• Gene Symbols: EDDM3A
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only